NTMT1 Peptide - N-terminal region
NTMT1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
NRMT, NRMT1, NTM1A, AD-003, HOMT1A, C9orf32, METTL11A
UniProt
Q9BV86
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NTMT1 Rabbit Polyclonal Antibody (orb55685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_054783
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470525-500 1x 500 µL
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details