Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDIT4L Peptide - middle region

DDIT4L Peptide - middle region

Product Specifications

Product Name Alternative

REDD2, Rtp801L

UniProt

Q96D03

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDIT4L Rabbit Polyclonal Antibody (orb55693) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660287

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zfp810 (NM_145612) AAV Particle
MR207357A1V 250 µL

Mouse Zfp810 (NM_145612) AAV Particle

Sign In for Pricing
View Details
Recombinant Human Galectin9 Protein
ARP2187-01 10 µg

Recombinant Human Galectin9 Protein

Sign In for Pricing
View Details
Recombinant Human Galectin9 Protein
ARP2187-02 50 µg

Recombinant Human Galectin9 Protein

Sign In for Pricing
View Details
Recombinant Human Galectin9 Protein
ARP2187-03 100 µg

Recombinant Human Galectin9 Protein

Sign In for Pricing
View Details
Recombinant Human Galectin9 Protein
ARP2187-04 1 mg

Recombinant Human Galectin9 Protein

Sign In for Pricing
View Details
Rabbit Polyclonal BRCC3 Antibody [Biotin]
NBP1-76831B 0.1 mL

Rabbit Polyclonal BRCC3 Antibody [Biotin]

Sign In for Pricing
View Details