Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARSB Peptide - C-terminal region

ARSB Peptide - C-terminal region

Product Specifications

Product Name Alternative

ASB, G4S, MPS6

UniProt

P15848

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARSB Rabbit Polyclonal Antibody (orb588213) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000037.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dystrotelin (DYTN) (NM_001093730) Human Over-expression Lysate
LY425986 100 µg

Dystrotelin (DYTN) (NM_001093730) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094L-03 2x 100 Tests

Elab Fluor® 488 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
ZDHHC20 Rabbit Polyclonal Antibody
TA383469 100 µL

ZDHHC20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C1orf100 Human Gene Knockout Kit (CRISPR)
KN415519 1 Kit

C1orf100 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details