Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC6 Peptide - C-terminal region

CCDC6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

H4, PTC, TPC, TST1, D10S170

UniProt

Q16204

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC6 Rabbit Polyclonal Antibody (orb588229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005427.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HMGTSHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBXN6 Protein Lysate (Human) with C-Ha Tag
49067031 100 µg

UBXN6 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum 10 kDa chaperonin (groS)
MBS1112272-01 0.02 mg (E-Coli)

Recombinant Corynebacterium glutamicum 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum 10 kDa chaperonin (groS)
MBS1112272-02 0.1 mg (E-Coli)

Recombinant Corynebacterium glutamicum 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum 10 kDa chaperonin (groS)
MBS1112272-03 0.02 mg (Yeast)

Recombinant Corynebacterium glutamicum 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum 10 kDa chaperonin (groS)
MBS1112272-04 0.1 mg (Yeast)

Recombinant Corynebacterium glutamicum 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum 10 kDa chaperonin (groS)
MBS1112272-05 0.02 mg (Baculovirus)

Recombinant Corynebacterium glutamicum 10 kDa chaperonin (groS)

Sign In for Pricing
View Details