Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC6 Peptide - C-terminal region

CCDC6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

H4, PTC, TPC, TST1, D10S170

UniProt

Q16204

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC6 Rabbit Polyclonal Antibody (orb588229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005427.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HMGTSHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EZH2-IN-17
BA4877-1 1 mg

EZH2-IN-17

Sign In for Pricing
View Details
PSGR Double Nickase Plasmid (m2)
sc-431273-NIC-2 20 µg

PSGR Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
NBS1/NBN Rabbit pAb
E921501 100 µL

NBS1/NBN Rabbit pAb

Sign In for Pricing
View Details
ERAS Mouse Monoclonal Antibody [D10-B9]
M1505-1 100 µL

ERAS Mouse Monoclonal Antibody [D10-B9]

Sign In for Pricing
View Details
Naga-set siRNA/shRNA/RNAi Lentivector (Mouse)
31398094 4x 500 ng

Naga-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Mouse Choline Acetylase CHAc ELISA Kit
BG-MUS10685 1 Each

Mouse Choline Acetylase CHAc ELISA Kit

Sign In for Pricing
View Details