Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST8 Peptide - N-terminal region

CHST8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSS3, GalNAc4ST, GALNAC4ST1

UniProt

Q9H2A9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHST8 Rabbit Polyclonal Antibody (orb588233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121367.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APQQVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERVTRDLSSGAPRGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At2g19130 Polyclonal Antibody
MBS7183608 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At2g19130 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human LCN1 shRNA (UAS) - Lentiviral human LCN1 shRNA (UAS) (100)
GTR15098706 1 Vial

Lentiviral human LCN1 shRNA (UAS) - Lentiviral human LCN1 shRNA (UAS) (100)

Sign In for Pricing
View Details
2,4-Dinitrotoluene
CS-T-20735 1 Each

2,4-Dinitrotoluene

Sign In for Pricing
View Details
TRAF3 (NM_003300) Human Tagged ORF Clone Lentiviral Particle
RC218682L2V 200 µL

TRAF3 (NM_003300) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ZIC3 Rabbit Polyclonal Antibody
E10G03698 100 µL

ZIC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GF 109203X 10mM * 1mL in DMSO
A13197-10mM-D 10 mM x 1mL in DMSO

GF 109203X 10mM * 1mL in DMSO

Sign In for Pricing
View Details