Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST8 Peptide - N-terminal region

CHST8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSS3, GalNAc4ST, GALNAC4ST1

UniProt

Q9H2A9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHST8 Rabbit Polyclonal Antibody (orb588233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121367.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APQQVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERVTRDLSSGAPRGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLX6 (Homeobox Protein DLX-6)
MBS6002064-01 0.1 mg

DLX6 (Homeobox Protein DLX-6)

Sign In for Pricing
View Details
DLX6 (Homeobox Protein DLX-6)
MBS6002064-02 5x 0.1 mg

DLX6 (Homeobox Protein DLX-6)

Sign In for Pricing
View Details
UGT2B15 Protein Lysate (Rat) with C-HA Tag
49131036 100 µg

UGT2B15 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Sodium Hexametaphosphate 62.0%
219815-01 25 Kg

Sodium Hexametaphosphate 62.0%

Sign In for Pricing
View Details
Sodium Hexametaphosphate 62.0%
219815-02 50 Kg

Sodium Hexametaphosphate 62.0%

Sign In for Pricing
View Details
Sodium Hexametaphosphate 62.0%
219815-03 500 g

Sodium Hexametaphosphate 62.0%

Sign In for Pricing
View Details