Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST8 Peptide - N-terminal region

CHST8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSS3, GalNAc4ST, GALNAC4ST1

UniProt

Q9H2A9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHST8 Rabbit Polyclonal Antibody (orb588233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121367.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APQQVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERVTRDLSSGAPRGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Folate Binding Protein (FOLR1) Rabbit Polyclonal Antibody
TA890253 100 µL

Folate Binding Protein (FOLR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZBED10P Pre-designed siRNA Set A
SI018409A 1 Each

Human ZBED10P Pre-designed siRNA Set A

Sign In for Pricing
View Details
Monkey Catenin Alpha 3 (CTNNA3) ELISA kit
GTR10404217 96 Well

Monkey Catenin Alpha 3 (CTNNA3) ELISA kit

Sign In for Pricing
View Details
Mouse Monoclonal SCYL1BP1 Antibody (OTI4F11) [Janelia Fluor 549]
NBP2-74029JF549 0.1 mL

Mouse Monoclonal SCYL1BP1 Antibody (OTI4F11) [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant Halorhodospira halophila UPF0761 membrane protein Hhal_0704 (Hhal_0704)
orb2909495-01 20 µg

Recombinant Halorhodospira halophila UPF0761 membrane protein Hhal_0704 (Hhal_0704)

Sign In for Pricing
View Details
Recombinant Halorhodospira halophila UPF0761 membrane protein Hhal_0704 (Hhal_0704)
orb2909495-02 100 µg

Recombinant Halorhodospira halophila UPF0761 membrane protein Hhal_0704 (Hhal_0704)

Sign In for Pricing
View Details