Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST8 Peptide - N-terminal region

CHST8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSS3, GalNAc4ST, GALNAC4ST1

UniProt

Q9H2A9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHST8 Rabbit Polyclonal Antibody (orb588233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121367.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APQQVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERVTRDLSSGAPRGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR14 Polyclonal Antibody, Cy3 Conjugated
bs-1806R-Cy3 100 µL

GPR14 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
SMYD3, NT (SET and MYND Domain-containing Protein 3, Zinc Finger MYND Domain-containing Protein 1, ZNFN3A1, ZMYND1) (MaxLight 490)
MBS6501752-01 0.1 mL

SMYD3, NT (SET and MYND Domain-containing Protein 3, Zinc Finger MYND Domain-containing Protein 1, ZNFN3A1, ZMYND1) (MaxLight 490)

Sign In for Pricing
View Details
SMYD3, NT (SET and MYND Domain-containing Protein 3, Zinc Finger MYND Domain-containing Protein 1, ZNFN3A1, ZMYND1) (MaxLight 490)
MBS6501752-02 5x 0.1 mL

SMYD3, NT (SET and MYND Domain-containing Protein 3, Zinc Finger MYND Domain-containing Protein 1, ZNFN3A1, ZMYND1) (MaxLight 490)

Sign In for Pricing
View Details
1,3-Dichlorobenzene-d4
TRC-D439663-1MG 1 mg

1,3-Dichlorobenzene-d4

Sign In for Pricing
View Details
AW555464 3'UTR Luciferase Stable Cell Line
TU102429 1.0 mL

AW555464 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Eda (NM_010099) Mouse Tagged Lenti ORF Clone
MR224097L3 10 µg

Eda (NM_010099) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details