Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP3 Peptide - middle region

MMP3 Peptide - middle region

Product Specifications

Product Name Alternative

SL-1, STMY, STR1, CHDS6, MMP-3, STMY1

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMP3 Rabbit Polyclonal Antibody (orb588644) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002413.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 / NCAM (NCAM1/795), 0.2mg/mL
BNUB0795-500 1x 500 µL

CD56 / NCAM (NCAM1/795), 0.2mg/mL

Sign In for Pricing
View Details
Syntaxin 16 (STX16) (NM_001001433) Human Over-expression Lysate
LY424352 100 µg

Syntaxin 16 (STX16) (NM_001001433) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB534287 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
CYFIP2 (NM_014376) Human Recombinant Protein
TP317082 20 µg

CYFIP2 (NM_014376) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS802342 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Mouse N-myc Downstream Regulated Gene 2 (NDRG2) ELISA Kit
RDR-NDRG2-Mu-01 96 Tests

Mouse N-myc Downstream Regulated Gene 2 (NDRG2) ELISA Kit

Sign In for Pricing
View Details