Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPY5R Peptide - N-terminal region

NPY5R Peptide - N-terminal region

Product Specifications

Product Name Alternative

NPYR5, NPY5-R, NPYY5-R

UniProt

Q15761

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPY5R Rabbit Polyclonal Antibody (orb588647) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006165.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brain Natriuretic Peptide (BNP) Antibody (Biotin)
abx271350-01 200 µL

Brain Natriuretic Peptide (BNP) Antibody (Biotin)

Sign In for Pricing
View Details
Brain Natriuretic Peptide (BNP) Antibody (Biotin)
abx271350-02 1 mL

Brain Natriuretic Peptide (BNP) Antibody (Biotin)

Sign In for Pricing
View Details
NRAS Recombinant Antibody, RBITC Conjugated
bsm-62922R-RBITC 100 µL

NRAS Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Human CEACAM7 Recombinant Protein C-6 His Tag Lyophilized 50UG
IHUCEACAM7RC6HISLY50UG 50 µg

Human CEACAM7 Recombinant Protein C-6 His Tag Lyophilized 50UG

Sign In for Pricing
View Details
Recombinant Lactococcus lactis subsp. lactis Alanine--tRNA ligase (alaS), partial
MBS1346946 Inquire

Recombinant Lactococcus lactis subsp. lactis Alanine--tRNA ligase (alaS), partial

Sign In for Pricing
View Details
RELB Peptide - N-terminal region
orb2018383 100 µg

RELB Peptide - N-terminal region

Sign In for Pricing
View Details