Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPY5R Peptide - N-terminal region

NPY5R Peptide - N-terminal region

Product Specifications

Product Name Alternative

NPYR5, NPY5-R, NPYY5-R

UniProt

Q15761

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPY5R Rabbit Polyclonal Antibody (orb588647) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006165.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCML2 Recombinant Protein Antigen
NBP2-56280PEP 100 µL

SCML2 Recombinant Protein Antigen

Sign In for Pricing
View Details
Rat Ataxin 1 ELISA kit
GTR10395091 96 Well

Rat Ataxin 1 ELISA kit

Sign In for Pricing
View Details
β3Gn-T4 (m) -PR
sc-108933-PR 10 µM - 20 µL

β3Gn-T4 (m) -PR

Sign In for Pricing
View Details
SUMO2 (Small Ubiquitin-related Modifier 2, HSMT3, MGC117191, SMT3B, SMT3H2, SUMO3, Smt3A,HSMT3,SMT3 homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A) (HRP)
MBS6439590-01 0.1 mL

SUMO2 (Small Ubiquitin-related Modifier 2, HSMT3, MGC117191, SMT3B, SMT3H2, SUMO3, Smt3A,HSMT3,SMT3 homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A) (HRP)

Sign In for Pricing
View Details
SUMO2 (Small Ubiquitin-related Modifier 2, HSMT3, MGC117191, SMT3B, SMT3H2, SUMO3, Smt3A,HSMT3,SMT3 homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A) (HRP)
MBS6439590-02 5x 0.1 mL

SUMO2 (Small Ubiquitin-related Modifier 2, HSMT3, MGC117191, SMT3B, SMT3H2, SUMO3, Smt3A,HSMT3,SMT3 homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A) (HRP)

Sign In for Pricing
View Details
Human Norovirus GII capsid C-terminal (P domain)
orb2309198 2 mg

Human Norovirus GII capsid C-terminal (P domain)

Sign In for Pricing
View Details