Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A2 Peptide - middle region

BTN2A2 Peptide - middle region

Product Specifications

Product Name Alternative

BTF2, BT2.2, BTN2.2

UniProt

Q8WVV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTN2A2 Rabbit Polyclonal Antibody (orb588756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001184166.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVRRGPYRQRVPDNPERFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Hydroxycyclopropanecarboxylic Acid
013617 100 mg

1-Hydroxycyclopropanecarboxylic Acid

Sign In for Pricing
View Details
Trimethylolpropane trimethacrylate
290860-01 1 Kg

Trimethylolpropane trimethacrylate

Sign In for Pricing
View Details
Trimethylolpropane trimethacrylate
290860-02 2 Kg

Trimethylolpropane trimethacrylate

Sign In for Pricing
View Details
Trimethylolpropane trimethacrylate
290860-03 5 Kg

Trimethylolpropane trimethacrylate

Sign In for Pricing
View Details
Trimethylolpropane trimethacrylate
290860-04 10 Kg

Trimethylolpropane trimethacrylate

Sign In for Pricing
View Details
Trimethylolpropane trimethacrylate
290860-05 25 Kg

Trimethylolpropane trimethacrylate

Sign In for Pricing
View Details