BTN2A2 Peptide - middle region
BTN2A2 Peptide - middle region
Product Specifications
Product Name Alternative
BTF2, BT2.2, BTN2.2
UniProt
Q8WVV5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BTN2A2 Rabbit Polyclonal Antibody (orb588756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001184166.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVRRGPYRQRVPDNPERFD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb775876-01 48 Tests
Human Visceral Adipose Tissue Derived Serine Protease Inhibitor (Vaspin) ELISA Kit
Sign In for Pricing
View Details orb775876-02 96 Tests
Human Visceral Adipose Tissue Derived Serine Protease Inhibitor (Vaspin) ELISA Kit
Sign In for Pricing
View Details 
PLAPG200BA 20000 Pieces/Case:1000 Pieces/ PACKS:20 PACKS/CASE
Universal pipette tips, 1 to 200 ul, universal fit tips, DNase/RNase free, bulk pack, yellow, 51mm, without filter,1000pcs/bag, 20bags/case
Sign In for Pricing
View Details