LILRA2 Peptide - middle region
LILRA2 Peptide - middle region
Product Specifications
Product Name Alternative
ILT1, LIR7, CD85H, LIR-7
UniProt
Q8N149
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LILRA2 Rabbit Polyclonal Antibody (orb588779) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006857.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVENL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P2488-05F 100 µg
PAK1 (Serine/Threonine-protein Kinase PAK 1, Alpha-PAK, p21-activated Kinase 1, PAK-1, p65-PAK) discontinued
Sign In for Pricing
View Details