LILRA2 Peptide - middle region
LILRA2 Peptide - middle region
Product Specifications
Product Name Alternative
ILT1, LIR7, CD85H, LIR-7
UniProt
Q8N149
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LILRA2 Rabbit Polyclonal Antibody (orb588779) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006857.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVENL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC226932L4V 200 µL
BDNF (NM_001143810) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS7190219 Inquire
Rabbit anti-Caenorhabditis elegans sra-29 Polyclonal Antibody
Sign In for Pricing
View Details 
302848 200 µL
YY1AP1 (YY1-Associated Protein 1, Hepatocellular Carcinoma Susceptibility Protein, Hepatocellular Carcinoma-Associated Protein 2, YY1AP1, HCCA2, YY1AP)
Sign In for Pricing
View Details