Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIM2 Peptide - N-terminal region

PIM2 Peptide - N-terminal region

Product Specifications

UniProt

Q9P1W9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIM2 Rabbit Polyclonal Antibody (orb588780) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006866.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LUZP4 Mouse Monoclonal Antibody [Clone ID: OTI3C10]
CF809087 100 µg

LUZP4 Mouse Monoclonal Antibody [Clone ID: OTI3C10]

Sign In for Pricing
View Details
Compounding Hood BCHL-403
BCHL-403 1 Unit

Compounding Hood BCHL-403

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (HHV8/3606), Biotin conjugate, 0.1mg/mL
BNCB3606-500 1x 500 µL

Human Herpes Virus 8 (HHV8) (HHV8/3606), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody
TA373191 100 µL

Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vitamin K3-d8
TRC-V676132-1MG 1 mg

Vitamin K3-d8

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS520387 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details