Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIM2 Peptide - N-terminal region

PIM2 Peptide - N-terminal region

Product Specifications

UniProt

Q9P1W9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIM2 Rabbit Polyclonal Antibody (orb588780) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006866.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD11B2 (NM_000196) Human Over-expression Lysate
LY424870 100 µg

HSD11B2 (NM_000196) Human Over-expression Lysate

Sign In for Pricing
View Details
KAT2A (NM_021078) Human Recombinant Protein
TP750233 50 µg

KAT2A (NM_021078) Human Recombinant Protein

Sign In for Pricing
View Details
HLA-DP (MHC II) (HLA-DPB1/2862R), CF488A conjugate, 0.1mg/mL
BNC882862-500 1x 500 µL

HLA-DP (MHC II) (HLA-DPB1/2862R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ENAH Human Gene Knockout Kit (CRISPR)
KN210677 1 Kit

ENAH Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TOX1 (TOX) (NM_014729) Human Recombinant Protein
TP303792 20 µg

TOX1 (TOX) (NM_014729) Human Recombinant Protein

Sign In for Pricing
View Details
FUCA1 Rabbit Polyclonal Antibody
AP17405PU-N 400 µL

FUCA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details