Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A1 Peptide - middle region

BTN2A1 Peptide - middle region

Product Specifications

Product Name Alternative

BTF1, BT2.1, BTN2.1, DJ3E1.1, BK14H9.1

UniProt

Q7KYR7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTN2A1 Rabbit Polyclonal Antibody (orb588782) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001184162.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRDSVERKGEVLLIPQNGFWTLEMHKGQYRAVSSPDRILPLKESLCRVGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dab1 Mouse qPCR Primer Pair (NM_177259)
MP220513 200 Reactions

Dab1 Mouse qPCR Primer Pair (NM_177259)

Sign In for Pricing
View Details
Eotaxin-2 Polyclonal Antibody
MBS8595347-01 0.1 mg

Eotaxin-2 Polyclonal Antibody

Sign In for Pricing
View Details
Eotaxin-2 Polyclonal Antibody
MBS8595347-02 0.1 mL (AF405L)

Eotaxin-2 Polyclonal Antibody

Sign In for Pricing
View Details
Eotaxin-2 Polyclonal Antibody
MBS8595347-03 0.1 mL (AF405S)

Eotaxin-2 Polyclonal Antibody

Sign In for Pricing
View Details
Eotaxin-2 Polyclonal Antibody
MBS8595347-04 0.1 mL (AF610)

Eotaxin-2 Polyclonal Antibody

Sign In for Pricing
View Details
Eotaxin-2 Polyclonal Antibody
MBS8595347-05 0.1 mL (AF635)

Eotaxin-2 Polyclonal Antibody

Sign In for Pricing
View Details