Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX19B Peptide - N-terminal region

DDX19B Peptide - N-terminal region

Product Specifications

Product Name Alternative

DBP5, RNAh, DDX19

UniProt

Q9UMR2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDX19B Rabbit Polyclonal Antibody (orb588784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014449.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary
CB519671 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS507123 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
PRDM9 Human Gene Knockout Kit (CRISPR)
KN418187 1 Kit

PRDM9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RatioWorks™ BCFL Acid *Superior replacement for BCECF*
21189-AAT 1 mg

RatioWorks™ BCFL Acid *Superior replacement for BCECF*

Sign In for Pricing
View Details
Recombinant Mouse PROK1 Protein (Sumo Tag)
PDEM100179-01 20 µg

Recombinant Mouse PROK1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Mouse PROK1 Protein (Sumo Tag)
PDEM100179-02 100 µg

Recombinant Mouse PROK1 Protein (Sumo Tag)

Sign In for Pricing
View Details