Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX19B Peptide - N-terminal region

DDX19B Peptide - N-terminal region

Product Specifications

Product Name Alternative

DBP5, RNAh, DDX19

UniProt

Q9UMR2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDX19B Rabbit Polyclonal Antibody (orb588784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014449.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Copeptin (CPP) ELISA Kit
RD-CPP-Mu-01 96 Tests

Mouse Copeptin (CPP) ELISA Kit

Sign In for Pricing
View Details
Mouse Copeptin (CPP) ELISA Kit
RD-CPP-Mu-02 48 Tests

Mouse Copeptin (CPP) ELISA Kit

Sign In for Pricing
View Details
ROBO3 Human Gene Knockout Kit (CRISPR)
KN416411 1 Kit

ROBO3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C-Myc (MYC275), CF594 conjugate, 0.1mg/mL
BNC940275-100 1x 100 µL

C-Myc (MYC275), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Oct-1 (POU2F1) Human Gene Knockout Kit (CRISPR)
KN208599BN 1 Kit

Oct-1 (POU2F1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TWIST1-specific antibody
FNab09118 100 µg

TWIST1-specific antibody

Sign In for Pricing
View Details