OR2H1 Peptide - C-terminal region
OR2H1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR2H6, OR2H8, OR6-2, 6M1-16, HS6M1-16, dJ994E9.4, OLFR42A-9004-14, OLFR42A-9004.14/9026.2
UniProt
Q9GZK4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR2H1 Rabbit Polyclonal Antibody (orb588813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_112145.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLLGKERDSRESWRAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-ITIH1-Hu-48Tests 48 Tests
Human Inter Alpha-Globulin Inhibitor H1 (ITIH1) ELISA Kit
Sign In for Pricing
View Details 
218450 50 µg
PLA2G7, Recombinant, Human, aa47-441, His-Tag (Platelet-Activating Factor Acetylhydrolase Precursor, Lipoprotein-Associated Phospholipase A2, LDL-PLA2, LP-PLA2, PAFAD, PAFAH)
Sign In for Pricing
View Details