OR2H1 Peptide - C-terminal region
OR2H1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR2H6, OR2H8, OR6-2, 6M1-16, HS6M1-16, dJ994E9.4, OLFR42A-9004-14, OLFR42A-9004.14/9026.2
UniProt
Q9GZK4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR2H1 Rabbit Polyclonal Antibody (orb588813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_112145.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLLGKERDSRESWRAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
835944 1 Pack (1 Panel (s) x 1 Pack)
P/P012/NT-PP-PHOLUMB-Dia 150/1-B Prohibited Activity Signs (No Adhesive)
Sign In for Pricing
View Details 