Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOX1 Peptide - C-terminal region

NOX1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOX1, NOH1, NOH-1, GP91-2

UniProt

Q9Y5S8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOX1 Rabbit Polyclonal Antibody (orb588814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001258744.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRP1 (ABCC1) Human shRNA Plasmid Kit (Locus ID 4363)
TG306920 1 Kit

MRP1 (ABCC1) Human shRNA Plasmid Kit (Locus ID 4363)

Sign In for Pricing
View Details
Anti-Hu CD326 PE
1P-581-T025 25 Tests

Anti-Hu CD326 PE

Sign In for Pricing
View Details
PAPPAS CRISPR Knock Out 293T Cell Line (Human)
63616141 1x 10^6 Cells / 1.0 mL

PAPPAS CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
PCR Plate (Skirted)
KD555002-10 0.2 mL

PCR Plate (Skirted)

Sign In for Pricing
View Details
EVX1 (NM_001989) Human Over-expression Lysate
E45H19616-2 20 µg

EVX1 (NM_001989) Human Over-expression Lysate

Sign In for Pricing
View Details
RPS21 Antibody
8C14107-AAT 50 µg

RPS21 Antibody

Sign In for Pricing
View Details