Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOX1 Peptide - C-terminal region

NOX1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOX1, NOH1, NOH-1, GP91-2

UniProt

Q9Y5S8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOX1 Rabbit Polyclonal Antibody (orb588814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001258744.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD206 Antibody
GWB-Q01446 0.25 mg

Mouse CD206 Antibody

Sign In for Pricing
View Details
CheZ Antibody
orb811704 2 mg

CheZ Antibody

Sign In for Pricing
View Details
PEX10 (NM_153818) Human Tagged ORF Clone
RC200588 10 µg

PEX10 (NM_153818) Human Tagged ORF Clone

Sign In for Pricing
View Details
Scg3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3372508 1.0 µg DNA

Scg3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Sox15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
45138116 3x 1.0 µg

Sox15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Zfp109 3'UTR Luciferase Stable Cell Line
TU122586 1.0 mL

Zfp109 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details