Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT1 Peptide - N-terminal region

NAT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AAC1, MNAT, NATI, NAT-1

UniProt

P18440

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAT1 Rabbit Polyclonal Antibody (orb588916) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000653.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS703027 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
3-Hydroxy Tibolone-d5 (mixture of 3alpha & 3beta isomers)
TRC-H964253-1MG 1 mg

3-Hydroxy Tibolone-d5 (mixture of 3alpha & 3beta isomers)

Sign In for Pricing
View Details
2-Chloromandelic acid
TRC-C432673-50G 50 g

2-Chloromandelic acid

Sign In for Pricing
View Details
HYI Rabbit Polyclonal Antibody
TA370736 100 µL

HYI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant DDB2 Antibody
RC-15972-01 50 μL

Recombinant DDB2 Antibody

Sign In for Pricing
View Details
Recombinant DDB2 Antibody
RC-15972-02 100 µL

Recombinant DDB2 Antibody

Sign In for Pricing
View Details