Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGS Peptide - C-terminal region

HGS Peptide - C-terminal region

Product Specifications

Product Name Alternative

HRS

UniProt

O14964

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HGS Rabbit Polyclonal Antibody (orb588919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004703.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibroblast Growth Factor 12 (FGF12) Antibody
abx176403 1 mL

Fibroblast Growth Factor 12 (FGF12) Antibody

Sign In for Pricing
View Details
IL-10 (E-10) AC
sc-8438 AC 500 µg/mL - 25% ag

IL-10 (E-10) AC

Sign In for Pricing
View Details
RB40A discontinued
541643-01 30ul

RB40A discontinued

Sign In for Pricing
View Details
RB40A discontinued
541643-02 100 µL

RB40A discontinued

Sign In for Pricing
View Details
Interferon alpha 2 antibody
70R-13172 100 µL

Interferon alpha 2 antibody

Sign In for Pricing
View Details
PF-04217903 (phenolsulfonate)
HY-12017B 1 Each

PF-04217903 (phenolsulfonate)

Sign In for Pricing
View Details