HGS Peptide - C-terminal region
HGS Peptide - C-terminal region
Product Specifications
Product Name Alternative
HRS
UniProt
O14964
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HGS Rabbit Polyclonal Antibody (orb588919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004703.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2909866-01 20 µg
Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbB (pcbB)
Sign In for Pricing
View Details orb2909866-02 100 µg
Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbB (pcbB)
Sign In for Pricing
View Details 
LV718325 1.0 µg DNA
AFF2-IT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
MBS1027624-01 0.02 mg (E-Coli)
Recombinant Vibrio fischeri Dihydrodipicolinate synthase (dapA)
Sign In for Pricing
View Details MBS1027624-02 0.02 mg (Yeast)
Recombinant Vibrio fischeri Dihydrodipicolinate synthase (dapA)
Sign In for Pricing
View Details MBS1027624-03 0.1 mg (E-Coli)
Recombinant Vibrio fischeri Dihydrodipicolinate synthase (dapA)
Sign In for Pricing
View Details