HSPA5 Peptide - middle region
HSPA5 Peptide - middle region
Product Specifications
Product Name Alternative
BIP, MIF2, GRP78, HEL-S-89n
UniProt
P11021
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HSPA5 Rabbit Polyclonal Antibody (orb588925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005338.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV784019 1.0 µg DNA
RPS21P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
042416-APC 200 µL
STMN3, CT (STMN3, SCLIP, Stathmin-3, SCG10-like protein) (APC) discontinued
Sign In for Pricing
View Details FAB20455G-100UG 100 µg
Human Galectin-9 Alexa Fluor 488 MAb (1005438)
Sign In for Pricing
View Details