Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPING1 Peptide - N-terminal region

SERPING1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C1IN, C1NH, HAE1, HAE2, C1INH

UniProt

P05155

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPING1 Rabbit Polyclonal Antibody (orb588932) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000053.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSNPNATSSSSQDPESLQDRGEGKVATTVISKMLFVEPILEVSSLPTTNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Inflammatory Protein-1 alpha (MIP-1a) (Lyophilized)
M1202-01H-01 100 µg

Macrophage Inflammatory Protein-1 alpha (MIP-1a) (Lyophilized)

Sign In for Pricing
View Details
Macrophage Inflammatory Protein-1 alpha (MIP-1a) (Lyophilized)
M1202-01H-02 500 µg

Macrophage Inflammatory Protein-1 alpha (MIP-1a) (Lyophilized)

Sign In for Pricing
View Details
MYL6B Antibody
E19-9022-2 100 µg -100 µL

MYL6B Antibody

Sign In for Pricing
View Details
Mouse CD82 antigen, CD82 ELISA Kit
MBS1604741-01 48 Well

Mouse CD82 antigen, CD82 ELISA Kit

Sign In for Pricing
View Details
Mouse CD82 antigen, CD82 ELISA Kit
MBS1604741-02 96 Well

Mouse CD82 antigen, CD82 ELISA Kit

Sign In for Pricing
View Details
Mouse CD82 antigen, CD82 ELISA Kit
MBS1604741-03 5x 96 Well

Mouse CD82 antigen, CD82 ELISA Kit

Sign In for Pricing
View Details