Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A4 Peptide - C-terminal region

SLC22A4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OCTN1

UniProt

Q9H015

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC22A4 Rabbit Polyclonal Antibody (orb588937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003050.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILTLFFPESLGMTLPETLEQMQKVKWFRSGKKTRDSMETEENPKVLITAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF 546
TRC-N392515-50MG 50 mg

NF 546

Sign In for Pricing
View Details
Sdf2 (BC058798) Mouse Tagged ORF Clone
MG202288 10 µg

Sdf2 (BC058798) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS809240 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
RPC5 Antibody
8C15478-AAT 50 µg

RPC5 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR560036 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Fndc11 Mouse Gene Knockout Kit (CRISPR)
KN502054 1 Kit

Fndc11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details