Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A4 Peptide - C-terminal region

SLC22A4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OCTN1

UniProt

Q9H015

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC22A4 Rabbit Polyclonal Antibody (orb588937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003050.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILTLFFPESLGMTLPETLEQMQKVKWFRSGKKTRDSMETEENPKVLITAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYL12B Polyclonal Antibody
E-AB-53541-01 20 µL

MYL12B Polyclonal Antibody

Sign In for Pricing
View Details
MYL12B Polyclonal Antibody
E-AB-53541-02 60 µL

MYL12B Polyclonal Antibody

Sign In for Pricing
View Details
MYL12B Polyclonal Antibody
E-AB-53541-03 120 µL

MYL12B Polyclonal Antibody

Sign In for Pricing
View Details
MYL12B Polyclonal Antibody
E-AB-53541-04 200 µL

MYL12B Polyclonal Antibody

Sign In for Pricing
View Details
C1QTNF1 Antibody
KC-1913-01 50 μL

C1QTNF1 Antibody

Sign In for Pricing
View Details
C1QTNF1 Antibody
KC-1913-02 100 µL

C1QTNF1 Antibody

Sign In for Pricing
View Details