Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCR3 Peptide - middle region

NCR3 Peptide - middle region

Product Specifications

Product Name Alternative

1C7, MALS, CD337, LY117, NKp30

UniProt

O14931

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCR3 Rabbit Polyclonal Antibody (orb588949) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138938.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAT8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A8]
TA500544BM 100 µL

NAT8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A8]

Sign In for Pricing
View Details
SH3BGR Protein Lysate (Rat) with C-HA Tag
43662036 100 µg

SH3BGR Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Rabbit Polyclonal DDX26B Antibody [Alexa Fluor 532]
NBP2-98078AF532 0.1 mL

Rabbit Polyclonal DDX26B Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Wiz siRNA Oligos set (Rat)
50437176 3x 5 nmol

Wiz siRNA Oligos set (Rat)

Sign In for Pricing
View Details
SLC35F5 Antibody (Biotin)
orb356788-01 50 µg

SLC35F5 Antibody (Biotin)

Sign In for Pricing
View Details
SLC35F5 Antibody (Biotin)
orb356788-02 100 µg

SLC35F5 Antibody (Biotin)

Sign In for Pricing
View Details