Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCR3 Peptide - middle region

NCR3 Peptide - middle region

Product Specifications

Product Name Alternative

1C7, MALS, CD337, LY117, NKp30

UniProt

O14931

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCR3 Rabbit Polyclonal Antibody (orb588949) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138938.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Pannexin-3 (PANX3) ELISA Kit
MBS9943001 Inquire

Goose Pannexin-3 (PANX3) ELISA Kit

Sign In for Pricing
View Details
DNA31 5mg
A18466-5 5 mg

DNA31 5mg

Sign In for Pricing
View Details
Cyclophilin A (CYPA) Monoclonal Antibody
CAU33462-01 100 µL

Cyclophilin A (CYPA) Monoclonal Antibody

Sign In for Pricing
View Details
Cyclophilin A (CYPA) Monoclonal Antibody
CAU33462-02 200 µL

Cyclophilin A (CYPA) Monoclonal Antibody

Sign In for Pricing
View Details
Cyclophilin A (CYPA) Monoclonal Antibody
CAU33462-03 1 mL

Cyclophilin A (CYPA) Monoclonal Antibody

Sign In for Pricing
View Details
TRP2 (E-10) HRP
sc-166716 HRP 200 µg/mL

TRP2 (E-10) HRP

Sign In for Pricing
View Details