Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2C Peptide - middle region

UBE2C Peptide - middle region

Product Specifications

Product Name Alternative

UBCH10, dJ447F3.2

UniProt

O00762

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2C Rabbit Polyclonal Antibody (orb578846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_861515

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAFPESDNLFKWVGTIHGAAGTAVGSIRTSSTVCLLSGPRETQDSSKPLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1133 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4170806 1.0 µg DNA

Olfr1133 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Mouse NPNT Protein, N-His
E55P6828 50 µg

Recombinant Mouse NPNT Protein, N-His

Sign In for Pricing
View Details
Rabbit anti-Mouse IgG Heavy and Light Chain Cross-Adsorbed Antibody FITC Conjugated
MBS3907282-01 0.5 mg

Rabbit anti-Mouse IgG Heavy and Light Chain Cross-Adsorbed Antibody FITC Conjugated

Sign In for Pricing
View Details
Rabbit anti-Mouse IgG Heavy and Light Chain Cross-Adsorbed Antibody FITC Conjugated
MBS3907282-02 5x 0.5 mg

Rabbit anti-Mouse IgG Heavy and Light Chain Cross-Adsorbed Antibody FITC Conjugated

Sign In for Pricing
View Details
Recombinant Helicobacter acinonychis Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS7073910 Inquire

Recombinant Helicobacter acinonychis Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details
Recombinant Human GRP78/HSPA5 Protein, N-His
orb3056590-01 50 µg

Recombinant Human GRP78/HSPA5 Protein, N-His

Sign In for Pricing
View Details