Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2C Peptide - middle region

UBE2C Peptide - middle region

Product Specifications

Product Name Alternative

UBCH10, dJ447F3.2

UniProt

O00762

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2C Rabbit Polyclonal Antibody (orb578846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_861515

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAFPESDNLFKWVGTIHGAAGTAVGSIRTSSTVCLLSGPRETQDSSKPLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caprin2 HDR Plasmid (h)
sc-408953-HDR 20 µg

Caprin2 HDR Plasmid (h)

Sign In for Pricing
View Details
Anti-TDG Antibody Picoband® Fluoro647 Conjugated
A15317-1-Fluoro647 100 µg/Vial

Anti-TDG Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Mouse CDH26 siRNA
abx911218-01 15 nmol

Mouse CDH26 siRNA

Sign In for Pricing
View Details
Mouse CDH26 siRNA
abx911218-02 30 nmol

Mouse CDH26 siRNA

Sign In for Pricing
View Details
RNASEH2A Protein Vector (Rat) (pPB-C-His)
PV301670 500 ng

RNASEH2A Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
RWDD2B shRNA (m) Lentiviral Particles
sc-153182-V 200 µL

RWDD2B shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details