Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC6 Peptide - N-terminal region

TTC6 Peptide - N-terminal region

Product Specifications

UniProt

Q86TZ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC6 Rabbit Polyclonal Antibody (orb580423) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007796

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SWNRAEMTMCALLAKVQMKAKRTKEAVEVLKKALDAISHSDKGPDATAIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cardiac Troponin T (TNNT2) (NM_001001432) Human Over-expression Lysate
LY424351 100 µg

Cardiac Troponin T (TNNT2) (NM_001001432) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ccdc126 activation kit by CRISPRa
GA206237 1 Kit

Mouse Ccdc126 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS637820 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707179 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Magnesium Sulfate
TRC-M198130-5G 5 g

Magnesium Sulfate

Sign In for Pricing
View Details
Human PD-L1 Recombinant Rabbit monoclonal Antibody
HA723742B 100 µL

Human PD-L1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details