Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC6 Peptide - N-terminal region

TTC6 Peptide - N-terminal region

Product Specifications

UniProt

Q86TZ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC6 Rabbit Polyclonal Antibody (orb580423) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007796

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SWNRAEMTMCALLAKVQMKAKRTKEAVEVLKKALDAISHSDKGPDATAIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TNKS2, C-His Tag
HA210560-01 20 µg

Human TNKS2, C-His Tag

Sign In for Pricing
View Details
Human TNKS2, C-His Tag
HA210560-02 50 µg

Human TNKS2, C-His Tag

Sign In for Pricing
View Details
Human TNKS2, C-His Tag
HA210560-03 100 µg

Human TNKS2, C-His Tag

Sign In for Pricing
View Details
2,3-Dibromo-2-(4-bromophenyl)propionic Acid
TRC-D425110-250MG 250 mg

2,3-Dibromo-2-(4-bromophenyl)propionic Acid

Sign In for Pricing
View Details
ANKRD34B Human Gene Knockout Kit (CRISPR)
KN422735 1 Kit

ANKRD34B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ankrd12 Mouse Gene Knockout Kit (CRISPR)
KN501265 1 Kit

Ankrd12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details