Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP7 Peptide - middle region

RBP7 Peptide - middle region

Product Specifications

Product Name Alternative

CRBP4, CRBPIV

UniProt

Q96R05

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBP7 Rabbit Polyclonal Antibody (orb581712) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443192

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM14 (NM_001198837) Human Tagged ORF Clone Lentiviral Particle
RC230953L3V 200 µL

RBM14 (NM_001198837) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-Bradykinin receptor B2 Rabbit Monoclonal Antibody
1439-01 20 μL

Anti-Bradykinin receptor B2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Bradykinin receptor B2 Rabbit Monoclonal Antibody
1439-02 100 μL

Anti-Bradykinin receptor B2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
OKCD08772-96W - CPN2 ELISA Kit (Rat)
OKCD08772-96W 96 Well

OKCD08772-96W - CPN2 ELISA Kit (Rat)

Sign In for Pricing
View Details
(1,3-Benzoxazol-2-ylsulfanyl) acetonitrile
orb3031264-01 100 mg

(1,3-Benzoxazol-2-ylsulfanyl) acetonitrile

Sign In for Pricing
View Details
(1,3-Benzoxazol-2-ylsulfanyl) acetonitrile
orb3031264-02 2 mg

(1,3-Benzoxazol-2-ylsulfanyl) acetonitrile

Sign In for Pricing
View Details