Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP52 Peptide - C-terminal region

CFAP52 Peptide - C-terminal region

Product Specifications

Product Name Alternative

WDR16, WDRPUH

UniProt

Q8N1V2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFAP52 Rabbit Polyclonal Antibody (orb581835) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659491

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTGGNDHLVKVWDYNEGEVTHVGVGHSGNITRIRISPGNQYIVSVSADGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQCF6 (NM_001143833) Human Over-expression Lysate
LC428376 20 µg

IQCF6 (NM_001143833) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM115C (TCAF2) (NM_001130025) Human Over-expression Lysate
LC427110 20 µg

FAM115C (TCAF2) (NM_001130025) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-PTPMT1
Y123086 100 µL

Anti-PTPMT1

Sign In for Pricing
View Details
ILF3 Human qPCR Primer Pair (NM_012218)
HP227379 200 Reactions

ILF3 Human qPCR Primer Pair (NM_012218)

Sign In for Pricing
View Details
Recombinant JNK1 (phospho T183) /JNK2 (phospho T183) /JNK3 (phospho T183) Antibody
RC-17002-01 50 μL

Recombinant JNK1 (phospho T183) /JNK2 (phospho T183) /JNK3 (phospho T183) Antibody

Sign In for Pricing
View Details
Recombinant JNK1 (phospho T183) /JNK2 (phospho T183) /JNK3 (phospho T183) Antibody
RC-17002-02 100 µL

Recombinant JNK1 (phospho T183) /JNK2 (phospho T183) /JNK3 (phospho T183) Antibody

Sign In for Pricing
View Details