Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP52 Peptide - C-terminal region

CFAP52 Peptide - C-terminal region

Product Specifications

Product Name Alternative

WDR16, WDRPUH

UniProt

Q8N1V2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFAP52 Rabbit Polyclonal Antibody (orb581835) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659491

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTGGNDHLVKVWDYNEGEVTHVGVGHSGNITRIRISPGNQYIVSVSADGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPA5 (NM_001127442) Human Over-expression Lysate
LC426785 20 µg

CPA5 (NM_001127442) Human Over-expression Lysate

Sign In for Pricing
View Details
PDGFA Polyclonal Antibody
E-AB-12839-01 20 µL

PDGFA Polyclonal Antibody

Sign In for Pricing
View Details
PDGFA Polyclonal Antibody
E-AB-12839-02 60 µL

PDGFA Polyclonal Antibody

Sign In for Pricing
View Details
PDGFA Polyclonal Antibody
E-AB-12839-03 120 µL

PDGFA Polyclonal Antibody

Sign In for Pricing
View Details
PDGFA Polyclonal Antibody
E-AB-12839-04 200 µL

PDGFA Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung: right upper lobe
CR562557 5 µg

Tissue Total RNA, Lung: right upper lobe

Sign In for Pricing
View Details