HOXB2 Peptide - middle region
HOXB2 Peptide - middle region
Product Specifications
Product Name Alternative
K8, HOX2, HOX2H, Hox-2.8
UniProt
P14652
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HOXB2 Rabbit Polyclonal Antibody (orb588278) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002136.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QVKVWFQNRRMKHKRQTQHREPPDGEPACPGALEDICDPAEEPAASPGGP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P005-410-125 1x 125 µL
ExoBriteTM 410/450 CD81 Flow Antibody (25 tests)
Sign In for Pricing
View Details ![CDK6 Mouse Monoclonal Antibody [Clone ID: 8H4]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fcfd4/imageurl/am31156pu-n.webp)
BNC941188-500 1x 500 µL
SUMO-1 (SUMO1/1188), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details