Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKZF1 Peptide - middle region

IKZF1 Peptide - middle region

Product Specifications

Product Name Alternative

IK1, LYF1, LyF-1, IKAROS, PPP1R92, PRO0758, ZNFN1A1, Hs.54452

UniProt

Q13422

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IKZF1 Rabbit Polyclonal Antibody (orb588280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001207694.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-Alpha Tubulin (12F6)
LF-MA0396 100 ul

anti-Alpha Tubulin (12F6)

Sign In for Pricing
View Details
Recombinant Bacillus cereus subsp. cytotoxis ATP synthase subunit delta (atpH)
MBS1066731-01 0.05 mg (E-Coli)

Recombinant Bacillus cereus subsp. cytotoxis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Bacillus cereus subsp. cytotoxis ATP synthase subunit delta (atpH)
MBS1066731-02 0.05 mg (Yeast)

Recombinant Bacillus cereus subsp. cytotoxis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Bacillus cereus subsp. cytotoxis ATP synthase subunit delta (atpH)
MBS1066731-03 0.2 mg (E-Coli)

Recombinant Bacillus cereus subsp. cytotoxis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Bacillus cereus subsp. cytotoxis ATP synthase subunit delta (atpH)
MBS1066731-04 0.5 mg (E-Coli)

Recombinant Bacillus cereus subsp. cytotoxis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Bacillus cereus subsp. cytotoxis ATP synthase subunit delta (atpH)
MBS1066731-05 0.05 mg (Baculovirus)

Recombinant Bacillus cereus subsp. cytotoxis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details