Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKZF1 Peptide - middle region

IKZF1 Peptide - middle region

Product Specifications

Product Name Alternative

IK1, LYF1, LyF-1, IKAROS, PPP1R92, PRO0758, ZNFN1A1, Hs.54452

UniProt

Q13422

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IKZF1 Rabbit Polyclonal Antibody (orb588280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001207694.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOS1AP Recombinant Protein
OPCD05726-50UG 50 µg

NOS1AP Recombinant Protein

Sign In for Pricing
View Details
UGT3A2 (NM_174914) Human Untagged Clone
SC127311 10 µg

UGT3A2 (NM_174914) Human Untagged Clone

Sign In for Pricing
View Details
Neuronal membrane glycoprotein M6 a (GPM6A) (NM_201591) Human Tagged ORF Clone Lentiviral Particle
RC205371L1V 200 µL

Neuronal membrane glycoprotein M6 a (GPM6A) (NM_201591) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Chicken Lumisterol ELISA Kit
MBS7281105-01 48 Well

Chicken Lumisterol ELISA Kit

Sign In for Pricing
View Details
Chicken Lumisterol ELISA Kit
MBS7281105-02 96 Well

Chicken Lumisterol ELISA Kit

Sign In for Pricing
View Details
Chicken Lumisterol ELISA Kit
MBS7281105-03 5x 96 Well

Chicken Lumisterol ELISA Kit

Sign In for Pricing
View Details