Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNAB2 Peptide - middle region

KCNAB2 Peptide - middle region

Product Specifications

Product Name Alternative

AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2

UniProt

Q13303

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNAB2 Rabbit Polyclonal Antibody (orb588287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001186789.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC16 discontinued
387222 200 µL

CDC16 discontinued

Sign In for Pricing
View Details
LIG1 Antibody : FITC (OAAF03012-FITC)
OAAF03012-100UG-FITC 100 µg

LIG1 Antibody : FITC (OAAF03012-FITC)

Sign In for Pricing
View Details
MTSS1L Protein Vector (Mouse) (pPM-C-HA)
PV202932 500 ng

MTSS1L Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
IKK gamma (IKBKG) Mouse Monoclonal Antibody [Clone ID: LBI3C3]
AMM20740V 100 µL

IKK gamma (IKBKG) Mouse Monoclonal Antibody [Clone ID: LBI3C3]

Sign In for Pricing
View Details
Mouse MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit
E39EM0135 96 Tests

Mouse MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit

Sign In for Pricing
View Details
AIG1 Antibody (N-term)
E45R14888G-4 50 µL

AIG1 Antibody (N-term)

Sign In for Pricing
View Details