Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNAB2 Peptide - middle region

KCNAB2 Peptide - middle region

Product Specifications

Product Name Alternative

AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2

UniProt

Q13303

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNAB2 Rabbit Polyclonal Antibody (orb588287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001186789.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2,5-Thiadiazole-3-carboxylic acid
sc-282299A 1 g

1,2,5-Thiadiazole-3-carboxylic acid

Sign In for Pricing
View Details
FOXE3 Polyclonal Antibody
orb3150581-01 50 µg

FOXE3 Polyclonal Antibody

Sign In for Pricing
View Details
FOXE3 Polyclonal Antibody
orb3150581-02 100 µg

FOXE3 Polyclonal Antibody

Sign In for Pricing
View Details
(1R,4R) -2-Methyl-2,5-diazabicyclo[2.2.1]heptane diHBr
IFA09795-01 1 g

(1R,4R) -2-Methyl-2,5-diazabicyclo[2.2.1]heptane diHBr

Sign In for Pricing
View Details
(1R,4R) -2-Methyl-2,5-diazabicyclo[2.2.1]heptane diHBr
IFA09795-02 10 g

(1R,4R) -2-Methyl-2,5-diazabicyclo[2.2.1]heptane diHBr

Sign In for Pricing
View Details
ASB3 Protein Vector (Mouse) (pPM-C-His)
PV156633 500 ng

ASB3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details