Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHSRP Peptide - middle region

KHSRP Peptide - middle region

Product Specifications

Product Name Alternative

FBP2, KSRP, FUBP2

UniProt

Q92945

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KHSRP Rabbit Polyclonal Antibody (orb588290) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003676.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laminin (A5), CF740 conjugate, 0.1mg/mL
BNC740308-500 1x 500 µL

Laminin (A5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C5ar1 Mouse Gene Knockout Kit (CRISPR)
KN302383LP 1 Kit

C5ar1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C6orf136 (NM_001109938) Human Over-expression Lysate
LY426309 100 µg

C6orf136 (NM_001109938) Human Over-expression Lysate

Sign In for Pricing
View Details
STING Recombinant Rabbit monoclonal Antibody
HA750437 100 µL

STING Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD81 / TAPA-1 (C81/2885R), CF488A conjugate, 0.1mg/mL
BNC882885-500 1x 500 µL

CD81 / TAPA-1 (C81/2885R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR559188 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details