Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF2C Peptide - middle region

KIF2C Peptide - middle region

Product Specifications

Product Name Alternative

MCAK, CT139, KNSL6

UniProt

Q99661

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF2C Rabbit Polyclonal Antibody (orb588292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001284584.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SCEYTLNTLRYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrombospondin 4 (m) -PR
sc-43194-PR 10 µM - 20 µL

Thrombospondin 4 (m) -PR

Sign In for Pricing
View Details
PPP2R3A Antibody
CSB-PA925621-01 50 μL

PPP2R3A Antibody

Sign In for Pricing
View Details
PPP2R3A Antibody
CSB-PA925621-02 100 µL

PPP2R3A Antibody

Sign In for Pricing
View Details
Calcium Sensing Receptor Antibody, PE Conjugated
bs-8524R-PE 100 µL

Calcium Sensing Receptor Antibody, PE Conjugated

Sign In for Pricing
View Details
NNMT (Nicotinamide N-methyltransferase) (MaxLight 490)
130445-ML490 100 µL

NNMT (Nicotinamide N-methyltransferase) (MaxLight 490)

Sign In for Pricing
View Details
Human Interleukin 15, IL-15 ELISA KIT
CSB-E04603h-01 48 Tests

Human Interleukin 15, IL-15 ELISA KIT

Sign In for Pricing
View Details