Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF2C Peptide - middle region

KIF2C Peptide - middle region

Product Specifications

Product Name Alternative

MCAK, CT139, KNSL6

UniProt

Q99661

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF2C Rabbit Polyclonal Antibody (orb588292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001284584.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SCEYTLNTLRYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SEPHS2 Antibody [DyLight 488]
NBP2-97672G 0.1 mL

Rabbit Polyclonal SEPHS2 Antibody [DyLight 488]

Sign In for Pricing
View Details
CASP8 Recombinant Protein
OPCD01905-200UG 200 µg

CASP8 Recombinant Protein

Sign In for Pricing
View Details
3110040N11Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
10532114 3x 1.0 µg

3110040N11Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Hsp-1221neo
110047 1 µg

Hsp-1221neo

Sign In for Pricing
View Details
Anti-GDF9 Polyclonal Antibody
PHA89801 100 μg

Anti-GDF9 Polyclonal Antibody

Sign In for Pricing
View Details
IRS-2, CT (Insulin Receptor Substrate 2, IRS2) (FITC) discontinued
I8700-18C-FITC 200 µL

IRS-2, CT (Insulin Receptor Substrate 2, IRS2) (FITC) discontinued

Sign In for Pricing
View Details