Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF2C Peptide - middle region

KIF2C Peptide - middle region

Product Specifications

Product Name Alternative

MCAK, CT139, KNSL6

UniProt

Q99661

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF2C Rabbit Polyclonal Antibody (orb588292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001284584.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SCEYTLNTLRYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (2-mercaptophenyl) -N'- (3-methylphenyl) thiourea
OR26761 1 Each

N- (2-mercaptophenyl) -N'- (3-methylphenyl) thiourea

Sign In for Pricing
View Details
VGF Rabbit Polyclonal Antibody
ES7497-01 50 µL

VGF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VGF Rabbit Polyclonal Antibody
ES7497-02 100 µL

VGF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calcr (NM_053816) Rat Tagged Lenti ORF Clone
RR200228L4 10 µg

Calcr (NM_053816) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
4- (4-Ethoxyphenyl) -5- (4-fluorophenyl) -4H-1,2,4-triazole-3-thiol
ECA54343-01 0.5 g

4- (4-Ethoxyphenyl) -5- (4-fluorophenyl) -4H-1,2,4-triazole-3-thiol

Sign In for Pricing
View Details
4- (4-Ethoxyphenyl) -5- (4-fluorophenyl) -4H-1,2,4-triazole-3-thiol
ECA54343-02 5 g

4- (4-Ethoxyphenyl) -5- (4-fluorophenyl) -4H-1,2,4-triazole-3-thiol

Sign In for Pricing
View Details