Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LASP1 Peptide - middle region

LASP1 Peptide - middle region

Product Specifications

Product Name Alternative

MLN50, Lasp-1

UniProt

Q14847

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LASP1 Rabbit Polyclonal Antibody (orb588295) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001258537.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPBC685.08 Antibody
orb858271 2 mg

SPBC685.08 Antibody

Sign In for Pricing
View Details
LSD1-IN-26
orb1982552-01 5 mg

LSD1-IN-26

Sign In for Pricing
View Details
LSD1-IN-26
orb1982552-02 50 mg

LSD1-IN-26

Sign In for Pricing
View Details
Rabbit Anti-Human Brk (phospho Tyr447) Polyclonal Antibody
PA88025HU-01 50 µg

Rabbit Anti-Human Brk (phospho Tyr447) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Brk (phospho Tyr447) Polyclonal Antibody
PA88025HU-02 100 µg

Rabbit Anti-Human Brk (phospho Tyr447) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Brk (phospho Tyr447) Polyclonal Antibody
PA88025HU-03 500 µg

Rabbit Anti-Human Brk (phospho Tyr447) Polyclonal Antibody

Sign In for Pricing
View Details