Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LASP1 Peptide - middle region

LASP1 Peptide - middle region

Product Specifications

Product Name Alternative

MLN50, Lasp-1

UniProt

Q14847

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LASP1 Rabbit Polyclonal Antibody (orb588295) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001258537.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Arm-PEG-Biotin (MW 10000)
HY-W1123943H 1 Each

8-Arm-PEG-Biotin (MW 10000)

Sign In for Pricing
View Details
CPSF7 Antibody
MBS8502200-01 0.1 mg

CPSF7 Antibody

Sign In for Pricing
View Details
CPSF7 Antibody
MBS8502200-02 0.1 mL (AF405L)

CPSF7 Antibody

Sign In for Pricing
View Details
CPSF7 Antibody
MBS8502200-03 0.1 mL (AF405S)

CPSF7 Antibody

Sign In for Pricing
View Details
CPSF7 Antibody
MBS8502200-04 0.1 mL (AF610)

CPSF7 Antibody

Sign In for Pricing
View Details
CPSF7 Antibody
MBS8502200-05 0.1 mL (AF635)

CPSF7 Antibody

Sign In for Pricing
View Details