Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYVE1 Peptide - C-terminal region

LYVE1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HAR, XLKD1, LYVE-1, CRSBP-1

UniProt

Q9Y5Y7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYVE1 Rabbit Polyclonal Antibody (orb588297) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006682.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX22 Antibody
8C11954-AAT 50 µg

TBX22 Antibody

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2753), CF640R conjugate, 0.1mg/mL
BNC402753-100 1x 100 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2753), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3’-Amino-2’-Hydroxy-[1,1’]biphenyl-3-carboxylic Acid
TRC-A611255-250MG 250 mg

3’-Amino-2’-Hydroxy-[1,1’]biphenyl-3-carboxylic Acid

Sign In for Pricing
View Details
CRISP2 (NM_001142407) Human Over-expression Lysate
LC428074 20 µg

CRISP2 (NM_001142407) Human Over-expression Lysate

Sign In for Pricing
View Details
Carbonic anhydrase 2 Mouse Monoclonal Antibody [11A2]
EM1801-14 100 µL

Carbonic anhydrase 2 Mouse Monoclonal Antibody [11A2]

Sign In for Pricing
View Details
Human SOD1 (Superoxide Dismutase 1, Soluble) ELISA Kit
E-EL-H1113-01 24 Tests

Human SOD1 (Superoxide Dismutase 1, Soluble) ELISA Kit

Sign In for Pricing
View Details